быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
CTP synthase / CTPS Rabbit mAb (A20912)
- Описание
- Характеристики
-
Overview
Product name CTP synthase / CTPS Rabbit mAb Catalog No. A20912 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2883 Background
This gene encodes an enzyme responsible for the catalytic conversion of UTP (uridine triphosphate) to CTP (cytidine triphospate). This reaction is an important step in the biosynthesis of phospholipids and nucleic acids. Activity of this proten is important in the immune system, and loss of function of this gene has been associated with immunodeficiency. Alternative splicing results in multiple transcript variants.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human CTP synthase / CTPS (P17812). Sequence SVRELRGLGLSPDLVVCRCSNPLDTSVKEKISMFCHVEPEQVICVHDVSSIYRVPLLLEEQGVVDYFLRRLDLPIERQPRKMLMKWKEMADRYDRLLETCS Gene ID Swiss Prot Synonyms CTPS; GATD5; IMD24; GATD5A Calculated MW 67kDa Observed MW 75kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, A-549, Mouse lung, Rat lung, Rat brain Cellular location cytoplasm, cytosol 
Western blot analysis of extracts of various cell lines, using CTP synthase/CTPS antibody (A20912) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of extracts of various cell lines, using CTP synthase/CTPS antibody (A20912) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human CTP synthase / CTPS (P17812). Isotype IgG