быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
PEF1 Rabbit mAb (A20914)
- Описание
- Характеристики
-
Overview
Product name PEF1 Rabbit mAb Catalog No. A20914 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2886 Background
This gene encodes a calcium-binding protein belonging to the penta-EF-hand protein family. The encoded protein has been shown to form a heterodimer with the programmed cell death 6 gene product and may modulate its function in Ca(2+) signaling. Alternative splicing results in multiple transcript variants and a pseudogene has been identified on chromosome 1.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human PEF1 (Q9UBV8). Sequence APGGPYGPPAGGGPYGHPNPGMFPSGTPGGPYGGAAPGGPYGQPPPSSYGAQQPGLYGQGGAPPNVDPEAYSWFQSVDSDHSGYISMKELKQALVNCNWSS Gene ID Swiss Prot Synonyms ABP32; PEF1A Calculated MW 30kDa Observed MW 30kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Jurkat, HeLa, 293T, Mouse liver, Rat pancreas Cellular location Cytoplasm, Membrane, Peripheral membrane protein 
Western blot analysis of extracts of various cell lines, using PEF1 antibody (A20914) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of extracts of Mouse liver, using PEF1 antibody (A20914) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human PEF1 (Q9UBV8). Isotype IgG