быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
PLSCR3 Rabbit mAb (A20915)
- Описание
- Характеристики
-
Overview
Product name PLSCR3 Rabbit mAb Catalog No. A20915 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2887 Background
Enables several functions, including calcium-dependent protein binding activity; metal ion binding activity; and phospholipid scramblase activity. Involved in several processes, including cardiolipin biosynthetic process; regulation of apoptotic process; and regulation of release of cytochrome c from mitochondria. Located in cytosol; mitochondrion; and plasma membrane.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PLSCR3 (Q9NRY6). Sequence MAGYLPPKGYAPSPPPPYPVTPGYPEPALHPGPGQAPVPAQVPAPAPGFALFPSPGPVALGSAAPFLPLPGVPSGLEFLVQIDQILIHQKAERVETFLGW Gene ID Swiss Prot Synonyms PLSCR3 Calculated MW 32kDa Observed MW 32kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples PC-3, A-431, Mouse lung, Mouse brain, Rat lung, Rat testis, Rat heart Cellular location Mitochondrion membrane, Single-pass type II membrane protein 
Western blot analysis of extracts of various lysates, using PLSCR3 antibody (A20915) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Western blot analysis of extracts of various cell lines, using PLSCR3 antibody (A20915) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PLSCR3 (Q9NRY6). Isotype IgG