быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
SPINK5 / LEKTI Rabbit mAb (A20916)
- Описание
- Характеристики
-
Overview
Product name SPINK5 / LEKTI Rabbit mAb Catalog No. A20916 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2888 Background
This gene encodes a multidomain serine protease inhibitor that contains 15 potential inhibitory domains. The encoded preproprotein is proteolytically processed to generate multiple protein products, which may exhibit unique activities and specificities. These proteins may play a role in skin and hair morphogenesis, as well as anti-inflammatory and antimicrobial protection of mucous epithelia. Mutations in this gene may result in Netherton syndrome, a disorder characterized by ichthyosis, defective cornification, and atopy. This gene is present in a gene cluster on chromosome 5. Alternative splicing results in multiple transcript variants.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human SPINK5 / LEKTI (Q9NQ38). Sequence FKKGERDGDFICPDYYEAVCGTDGKTYDNRCALCAENAKTGSQIGVKSEGECKSSNPEQDVCSAFRPFVRDGRLGCTRENDPVLGPDGKTHGNKCAMCAEL Gene ID Swiss Prot Synonyms NS; NETS; LEKTI; LETKI; VAKTI Calculated MW 121kDa Observed MW 37kDa/65kDa/145kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, MCF7, RAW264.7, Mouse skin, Mouse stomach, Rat stomach Cellular location Secreted 
Western blot analysis of extracts of various cell lines, using SPINK5/LEKTI antibody (A20916) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human SPINK5 / LEKTI (Q9NQ38). Isotype IgG







