быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
OXGR1 / GPR99 Rabbit mAb (A20918)
- Описание
- Характеристики
-
Overview
Product name OXGR1 / GPR99 Rabbit mAb Catalog No. A20918 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2892 Background
This gene encodes a G protein-coupled receptor (GPCR) that belongs to the oxoglutarate receptor family within the GPCR superfamily. The encoded protein is activated by the citric acid intermediate, oxoglutarate, as well as several cysteinyl leukotrienes, including leukotrienes E4, C4 and D4, which are implicated in many inflammatory disorders. In mice, a knock-out of this gene leads to middle ear inflammation, changes in the mucosal epithelium, and an increase in fluid behind the eardrum, and is associated with hearing loss. Alternative splicing results in multiple transcript variants.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 150-250 of human OXGR1 / GPR99 (Q96P68). Sequence AVVACAVVWIISLVAVIPMTFLITSTNRTNRSACLDLTSSDELNTIKWYNLILTATTFCLPLVIVTLCYTTIIHTLTHGLQTDSCLKQKARRLTILLLLAF Gene ID Swiss Prot Synonyms aKGR; GPR80; GPR99; P2Y15; P2RY15 Calculated MW 38kDa Observed MW 40kDa Applications
Reactivity Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples Mouse kidney, Rat kidney Cellular location Cell membrane, Multi-pass membrane protein 
Western blot analysis of extracts of various cell lines, using OXGR1/GPR99 antibody (A20918) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Immunofluorescence analysis of A-549 cells using OXGR1 / GPR99 Rabbit mAb (A20918) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 150-250 of human OXGR1 / GPR99 (Q96P68). Isotype IgG







