быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
PIN4 Rabbit mAb (A20919)
- Описание
- Характеристики
-
Overview
Product name PIN4 Rabbit mAb Catalog No. A20919 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2893 Background
This gene encodes a member of the parvulin subfamily of the peptidyl-prolyl cis/trans isomerase protein family. The encoded protein catalyzes the isomerization of peptidylprolyl bonds, and may play a role in the cell cycle, chromatin remodeling, and/or ribosome biogenesis. The encoded protein may play an additional role in the mitochondria.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 52-131 of human PIN4 (Q9Y237). Sequence MEAMEKLKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK Gene ID Swiss Prot Synonyms EPVH; PAR14; PAR17; hEPVH; hPar14; hPar17 Calculated MW 14kDa Observed MW 14kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples 293T, HepG2, U-251MG, Mouse liver, Rat brain, Rat thymus Cellular location cytoplasm, mitochondrial matrix, nucleolus, nucleoplasm, nucleus, spindle 
Western blot analysis of extracts of various cell lines, using PIN4 antibody (A20919) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 52-131 of human PIN4 (Q9Y237). Isotype IgG