быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
EPHX2 Rabbit mAb (A20920)
- Описание
- Характеристики
-
Overview
Product name EPHX2 Rabbit mAb Catalog No. A20920 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2895 Background
This gene encodes a member of the epoxide hydrolase family. The protein, found in both the cytosol and peroxisomes, binds to specific epoxides and converts them to the corresponding dihydrodiols. Mutations in this gene have been associated with familial hypercholesterolemia. Alternatively spliced transcript variants have been described.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human EPHX2 (P34913). Sequence MTLRAAVFDLDGVLALPAVFGVLGRTEEALALPRGLLNDAFQKGGPEGATTRLMKGEITLSQWIPLMEENCRKCSETAKVCLPKNFSIKEIFDKAISARK Gene ID Swiss Prot Synonyms CEH; SEH; ABHD20 Calculated MW 63kDa Observed MW 62kDa Applications
Reactivity Mouse, Rat Tested applications WB Recommended dilution - WB 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Mouse liver, Mouse kidney, Mouse heart, Rat heart Cellular location Cytoplasm, Peroxisome 
Western blot analysis of extracts of various cell lines, using EPHX2 antibody (A20920) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of extracts of Rat heart, using EPHX2 antibody (A20920) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human EPHX2 (P34913). Isotype IgG