быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
DTYMK Rabbit mAb (A20921)
- Описание
- Характеристики
-
Overview
Product name DTYMK Rabbit mAb Catalog No. A20921 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2896 Background
Enables thymidylate kinase activity. Predicted to be involved in dTDP biosynthetic process; dTTP biosynthetic process; and dUDP biosynthetic process. Predicted to act upstream of or within cellular response to growth factor stimulus and nucleotide biosynthetic process. Predicted to be located in mitochondrial intermembrane space and mitochondrial matrix. Predicted to be active in cytosol; mitochondrion; and nucleus.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human DTYMK (P23919). Sequence FSGVAFTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENGAFQERALRCFHQLMKDTTLNWKMVDASKSIEAVHEDIRVLSEDAIR Gene ID Swiss Prot Synonyms CDC8; TMPK; TYMK; CONPM; PP3731 Calculated MW 24kDa Observed MW 24kDa Applications
Reactivity Human Tested applications WB IF/ICC Recommended dilution - WB 1:100 - 1:500
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples HeLa, K-562, Raji Cellular location cytoplasm, cytosol, mitochondrion, nucleus 
Western blot analysis of extracts of various cell lines, using DTYMK antibody (A20921) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
Immunofluorescence analysis of MCF7 cells using DTYMK Rabbit mAb (A20921) at dilution of 1:20 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human DTYMK (P23919). Isotype IgG