быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
DNAJC12 Rabbit mAb (A20923)
- Описание
- Характеристики
-
Overview
Product name DNAJC12 Rabbit mAb Catalog No. A20923 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2898 Background
This gene encodes a member of a subclass of the HSP40/DnaJ protein family. Members of this family of proteins are associated with complex assembly, protein folding, and export. Two transcript variants encoding distinct isoforms have been identified for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 99-198 of human DNAJC12 (Q9UKB3). Sequence TSMHWVVRGKKDLMLEESDKTHTTKMENEECNEQRERKKEELASTAEKTEQKEPKPLEKSVSPQNSDSSGFADVNGWHLRFRWSKDAPSELLRKFRNYEI Gene ID Swiss Prot Synonyms JDP1; HPANBH4 Calculated MW 23kDa Observed MW 23kDa Applications
Reactivity Mouse Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Mouse pancreas Cellular location Cytoplasm 
Western blot analysis of extracts of Mouse pancreas, using DNAJC12 antibody (A20923) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 99-198 of human DNAJC12 (Q9UKB3). Isotype IgG