быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
CYFIP1 Rabbit mAb (A20924)
- Описание
- Характеристики
-
Overview
Product name CYFIP1 Rabbit mAb Catalog No. A20924 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2899 Background
This gene encodes a protein that regulates cytoskeletal dynamics and protein translation. The encoded protein is a component of the WAVE regulatory complex (WRC), which promotes actin polymerization. This protein also interacts with the synaptic functional regulator FMR1 protein and translation initiation factor 4E to inhibit protein translation. A large chromosomal deletion including this gene is associated with increased risk of schizophrenia and epilepsy in human patients. Reduced expression of this gene has been observed in various human cancers and the encoded protein may inhibit tumor invasion.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CYFIP1 (Q7L576). Sequence MAAQVTLEDALSNVDLLEELPLPDQQPCIEPPPSSLLYQPNFNTNFEDRNAFVTGIARYIEQATVHSSMNEMLEEGQEYAVMLYTWRSCSRAIPQVKCNE Gene ID Swiss Prot Synonyms SHYC; SRA1; SRA-1; P140SRA-1 Calculated MW 145kDa Observed MW 145kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:100 - 1:500
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples HeLa, Jurkat, K-562, Mouse lung, Mouse placenta, Rat lung, Rat brain Cellular location Cytoplasm, Synapse 
Western blot analysis of extracts of various cell lines, using CYFIP1 antibody (A20924) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunofluorescence analysis of A-549 cells using CYFIP1 Rabbit mAb (A20924) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CYFIP1 (Q7L576). Isotype IgG