быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
EXOC3 Rabbit mAb (A20925)
- Описание
- Характеристики
-
Overview
Product name EXOC3 Rabbit mAb Catalog No. A20925 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2900 Background
The protein encoded by this gene is a component of the exocyst complex, a multiple protein complex essential for targeting exocytic vesicles to specific docking sites on the plasma membrane. Though best characterized in yeast, the component proteins and functions of exocyst complex have been demonstrated to be highly conserved in higher eukaryotes. At least eight components of the exocyst complex, including this protein, are found to interact with the actin cytoskeletal remodeling and vesicle transport machinery. The complex is also essential for the biogenesis of epithelial cell surface polarity.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 650-745 of human EXOC3 (O60645). Sequence EDVDGYCDTIVAVAEVIKLTDPSLLYLEVSTLVSKYPDIRDDHIGALLAVRGDASRDMKQTIMETLEQGPAQASPSYVPLFKDIVVPSLNVAKLLK Gene ID Swiss Prot Synonyms SEC6; Sec6p; SEC6L1 Calculated MW 86kDa Observed MW 85kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, HepG2, MCF7, U-251MG, Mouse brain, Rat brain Cellular location cytosol, exocyst, Golgi apparatus, growth cone, perinuclear region of cytoplasm, presynaptic membrane 
Western blot analysis of extracts of various cell lines, using EXOC3 antibody (A20925) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 650-745 of human EXOC3 (O60645). Isotype IgG