быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
SF3A3 Rabbit mAb (A20927)
- Описание
- Характеристики
-
Overview
Product name SF3A3 Rabbit mAb Catalog No. A20927 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2903 Background
This gene encodes subunit 3 of the splicing factor 3a protein complex. The splicing factor 3a heterotrimer includes subunits 1, 2 and 3 and is necessary for the in vitro conversion of 15S U2 snRNP into an active 17S particle that performs pre-mRNA splicing. Subunit 3 interacts with subunit 1 through its amino-terminus while the zinc finger domain of subunit 3 plays a role in its binding to the 15S U2 snRNP. This gene has a pseudogene on chromosome 20. Alternative splicing results in multiple transcript variants.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SF3A3 (Q12874). Sequence METILEQQRRYHEEKERLMDVMAKEMLTKKSTLRDQINSDHRTRAMQDRYMEVSGNLRDLYDDKDGLRKEELNAISGPNEFAEFYNRLKQIKEFHRKHPN Gene ID Swiss Prot Synonyms PRP9; PRPF9; SAP61; SF3a60 Calculated MW 59kDa Observed MW 62kDa Applications
Reactivity Human, Mouse Tested applications WB Recommended dilution - WB 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, A-431, NIH/3T3, K-562, Raji, Mouse liver, Mouse brain Cellular location Nucleus speckle 
Western blot analysis of extracts of various cell lines, using SF3A3 antibody (A20927) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SF3A3 (Q12874). Isotype IgG