быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
KIF5B Rabbit mAb (A20928)
- Описание
- Характеристики
-
Overview
Product name KIF5B Rabbit mAb Catalog No. A20928 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2904 Background
Enables identical protein binding activity; microtubule binding activity; and microtubule motor activity. Involved in several processes, including lysosome localization; natural killer cell mediated cytotoxicity; and positive regulation of protein localization to plasma membrane. Located in centriolar satellite; cytosol; and vesicle.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human KIF5B (NP_004512.1). Sequence MADLAECNIKVMCRFRPLNESEVNRGDKYIAKFQGEDTVVIASKPYAFDRVFQSSTSQEQVYNDCAKKIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLH Gene ID Swiss Prot Synonyms KNS; KINH; KNS1; UKHC; HEL-S-61 Calculated MW 110kDa Observed MW 120kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:1000 - 1:5000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples 293T, HepG2, Mouse lung, Rat skeletal muscle, Mouse brain, Rat brain, Rat heart Cellular location Cytoplasm, Cytoskeleton Customer validation WB(Homo sapiens)
IF(Homo sapiens)
Western blot analysis of extracts of various cell lines, using KIF5B antibody (A20928) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
Immunofluorescence analysis of HeLa cells using KIF5B Rabbit mAb (A20928) at dilution of 1:20 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human KIF5B (NP_004512.1). Isotype IgG