быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Syndecan 3 Rabbit mAb (A20929)
- Описание
- Характеристики
-
Overview
Product name Syndecan 3 Rabbit mAb Catalog No. A20929 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2907 Background
The protein encoded by this gene belongs to the syndecan proteoglycan family. It may play a role in the organization of cell shape by affecting the actin cytoskeleton, possibly by transferring signals from the cell surface in a sugar-dependent mechanism. Allelic variants of this gene have been associated with obesity.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Syndecan 3 (O75056). Sequence MKPGPPHRAGAAHGAGAGAGAAAGPGARGLLLPPLLLLLLAGRAAGAQRWRSENFERPVDLEGSGDDDSFPDDELDDLYSGSGSGYFEQESGIETAMRFS Gene ID Swiss Prot Synonyms SDCN; SYND3 Calculated MW 45kDa Observed MW 70kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples U-251MG, MCF7, A-549, Mouse lung, Mouse spleen, Rat lung Cellular location cell surface, Golgi lumen, lysosomal lumen, microspike, plasma membrane 
Western blot analysis of extracts of various cell lines, using Syndecan 3 antibody (A20929) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Syndecan 3 (O75056). Isotype IgG