быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Glyt2 Rabbit mAb (A20931)
- Описание
- Характеристики
-
Overview
Product name Glyt2 Rabbit mAb Catalog No. A20931 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2912 Background
This gene encodes a sodium- and chloride-dependent glycine neurotransmitter transporter. This integral membrane glycoprotein is responsible for the clearance of extracellular glycine during glycine-mediated neurotransmission. This protein is found in glycinergic axons and maintains a high presynaptic pool of neurotransmitter at glycinergic synapses. Mutations in this gene cause hyperekplexia; a heterogenous neurological disorder characterized by exaggerated startle responses and neonatal apnea. Two transcript variants encoding different isoforms have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 250-350 of human Glyt2 (Q9Y345). Sequence SLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVISDHPKIQIKNSTFCMTA Gene ID Swiss Prot Synonyms NET1; GLYT2; HKPX3; GLYT-2 Calculated MW 87kDa Observed MW 87kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples U-937, SH-SY5Y, Mouse spinal cord, Mouse brain, Mouse lung, Rat spinal cord, Rat brain Cellular location Membrane, Multi-pass membrane protein 
Western blot analysis of extracts of various cell lines, using Glyt2 antibody (A20931) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 250-350 of human Glyt2 (Q9Y345). Isotype IgG







