быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
ITPK1 Rabbit mAb (A20939)
- Описание
- Характеристики
-
Overview
Product name ITPK1 Rabbit mAb Catalog No. A20939 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2924 Background
This gene encodes an enzyme that belongs to the inositol 1, 3, 4-trisphosphate 5/6-kinase family. This enzyme regulates the synthesis of inositol tetraphosphate, and downstream products, inositol pentakisphosphate and inositol hexakisphosphate. Inositol metabolism plays a role in the development of the neural tube. Disruptions in this gene are thought to be associated with neural tube defects. A pseudogene of this gene has been identified on chromosome X.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 315-414 of human ITPK1 (Q13572). Sequence HIATVLQGQSTAMAATGDVALLRHSKLLAEPAGGLVGERTCSASPGCCGSMMGQDAPWKAEADAGGTAKLPHQRLGCNAGVSPSFQQHCVASLATKASSQ Gene ID Swiss Prot Synonyms ITRPK1 Calculated MW 46kDa Observed MW 46kDa Applications
Reactivity Human, Mouse Tested applications WB IHC-P Recommended dilution - WB 1:100 - 1:500
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples NCI-H460 Cellular location Apical plasma membrane, Cytosol 
Western blot analysis of extracts of NCI-H460 cells, using ITPK1 antibody (A20939) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunohistochemistry analysis of paraffin-embedded mouse brain using ITPK1 Rabbit mAb (A20939) at dilution of 1:20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse kidney using ITPK1 Rabbit mAb (A20939) at dilution of 1:20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse spinal cord using ITPK1 Rabbit mAb (A20939) at dilution of 1:20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 315-414 of human ITPK1 (Q13572). Isotype IgG