быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Pyrophosphatase 1 Rabbit mAb (A20942)
- Описание
- Характеристики
-
Overview
Product name Pyrophosphatase 1 Rabbit mAb Catalog No. A20942 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2928 Background
The protein encoded by this gene is a member of the inorganic pyrophosphatase (PPase) family. PPases catalyze the hydrolysis of pyrophosphate to inorganic phosphate, which is important for the phosphate metabolism of cells. Studies of a similar protein in bovine suggested a cytoplasmic localization of this enzyme.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Pyrophosphatase 1 (Q15181). Sequence MSGFSTEERAAPFSLEYRVFLKNEKGQYISPFHDIPIYADKDVFHMVVEVPRWSNAKMEIATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQT Gene ID Swiss Prot Synonyms PP; PP1; IOPPP; HEL-S-66p; SID6-8061 Calculated MW 33kDa Observed MW 33kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples MCF7, OVCAR3, Mouse large intestine, Mouse liver, Rat liver Cellular location Cytoplasm 
Western blot analysis of extracts of various cell lines, using Pyrophosphatase 1 antibody (A20942) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Pyrophosphatase 1 (Q15181). Isotype IgG