быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
GPRC5B Rabbit mAb (A20946)
- Описание
- Характеристики
-
Overview
Product name GPRC5B Rabbit mAb Catalog No. A20946 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2932 Background
This gene encodes a member of the type 3 G protein-coupled receptor family. Members of this superfamily are characterized by a signature 7-transmembrane domain motif. The encoded protein may modulate insulin secretion and increased protein expression is associated with type 2 diabetes. Alternative splicing results in multiple transcript variants.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 304-403 of human GPRC5B (NP_057319.1). Sequence TPNYFDTSQPRMRETAFEEDVQLPRAYMENKAFSMDEHNAALRTAGFPNGSLGKRPSGSLGKRPSAPFRSNVYQPTEMAVVLNGGTIPTAPPSHTGRHLW Gene ID Swiss Prot Synonyms RAIG2; RAIG-2 Calculated MW 45kDa Observed MW 45kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples A549, K-562 (Low expression control), Mouse kidney Cellular location cell surface, cytosol, extracellular exosome, extracellular space, nucleolus, nucleoplasm, plasma membrane 
Western blot analysis of extracts of various cell lines, using GPRC5B antibody (A20946) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 304-403 of human GPRC5B (NP_057319.1). Isotype IgG