быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
NgR3 Rabbit mAb (A20947)
- Описание
- Характеристики
-
Overview
Product name NgR3 Rabbit mAb Catalog No. A20947 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2933 Background
Enables signaling receptor activity. Predicted to be involved in negative regulation of axon regeneration. Located in cell surface. Is anchored component of plasma membrane.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 342-441 of human NgR3 (Q86UN2). Sequence PHGPRPGHRKPGKNCTNPRNRNQISKAGAGKQAPELPDYAPDYQHKFSFDIMPTARPKRKGKCARRTPIRAPSGVQQASSASSLGASLLAWTLGLAVTLR Gene ID Swiss Prot Synonyms NgR3; NGRH2 Calculated MW 49kDa Observed MW 49kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples SH-SY5Y, Mouse brain, Rat brain, T47D Cellular location Cell membrane, GPI-anchor, Lipid-anchor 
Western blot analysis of extracts of various cell lines, using NgR3 antibody (A20947) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunohistochemistry analysis of paraffin-embedded human brain using NgR3 Rabbit mAb (A20947) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse brain using NgR3 Rabbit mAb (A20947) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse spinal cord using NgR3 Rabbit mAb (A20947) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded rat brain using NgR3 Rabbit mAb (A20947) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded rat kidney using NgR3 Rabbit mAb (A20947) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of mouse brain using NgR3 Rabbit mAb (A20947) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IF staining protocol.
Immunofluorescence analysis of rat brain using NgR3 Rabbit mAb (A20947) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of SH-SY5Y cells using NgR3 Rabbit mAb (A20947) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 342-441 of human NgR3 (Q86UN2). Isotype IgG