быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
DLX3 Rabbit mAb (A20948)
- Описание
- Характеристики
-
Overview
Product name DLX3 Rabbit mAb Catalog No. A20948 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2934 Background
Many vertebrate homeo box-containing genes have been identified on the basis of their sequence similarity with Drosophila developmental genes. Members of the Dlx gene family contain a homeobox that is related to that of Distal-less (Dll), a gene expressed in the head and limbs of the developing fruit fly. The Distal-less (Dlx) family of genes comprises at least 6 different members, DLX1-DLX6. Trichodentoosseous syndrome (TDO), an autosomal dominant condition, has been correlated with DLX3 gene mutation. This gene is located in a tail-to-tail configuration with another member of the gene family on the long arm of chromosome 17. Mutations in this gene have been associated with the autosomal dominant conditions trichodentoosseous syndrome and amelogenesis imperfecta with taurodontism.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 188-287 of human DLX3 (O60479). Sequence YKNGEVPLEHSPNNSDSMACNSPPSPALWDTSSHSTPAPARSQLPPPLPYSASPSYLDDPTNSWYHAQNLSGPHLQQQPPQPATLHHASPGPPPNPGAVY Gene ID Swiss Prot Synonyms AI4; TDO Calculated MW 32kDa Observed MW 38kDa Applications
Reactivity Human, Mouse Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples T47D, 293T, SK-BR-3, Mouse placenta Cellular location Nucleus 
Western blot analysis of extracts of various cell lines, using DLX3 antibody (A20948) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 188-287 of human DLX3 (O60479). Isotype IgG







