быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
eIF1A Rabbit mAb (A20954)
- Описание
- Характеристики
-
Overview
Product name eIF1A Rabbit mAb Catalog No. A20954 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2941 Background
This gene encodes an essential eukaryotic translation initiation factor. The protein is required for the binding of the 43S complex (a 40S subunit, eIF2/GTP/Met-tRNAi and eIF3) to the 5' end of capped RNA.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 65-144 of human eIF1A (P47813). Sequence LRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI Gene ID Swiss Prot Synonyms EIF1A; EIF4C; eIF-1A; eIF-4C; EIF1AP1 Calculated MW 16kDa Observed MW 16kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples HeLa, Mouse liver, Mouse testis, Mouse brain Cellular location Cytoplasm, Cytosol, Synapse 
Western blot analysis of extracts of various lysates, using eIF1A antibody (A20954) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using eIF1A Rabbit mAb (A20954) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse pancreas using eIF1A Rabbit mAb (A20954) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded rat brain using eIF1A Rabbit mAb (A20954) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 65-144 of human eIF1A (P47813). Isotype IgG