быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
PREB Rabbit mAb (A20957)
- Описание
- Характеристики
-
Overview
Product name PREB Rabbit mAb Catalog No. A20957 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2945 Background
This gene encodes a protein that specifically binds to a Pit1-binding element of the prolactin (PRL) promoter. This protein may act as a transcriptional regulator and is thought to be involved in some of the developmental abnormalities observed in patients with partial trisomy 2p. This gene overlaps the abhydrolase domain containing 1 (ABHD1) gene on the opposite strand.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 89-201 of human PREB (NP_037520.1). Sequence HCQLLRFQAHQQQGNKAEKAGSKEQGPRQRKGAAPAEKKCGAETQHEGLELRVENLQAVQTDFSSDPLQKVVCFNHDNTLLATGGTDGYVRVWKVPSLEKVLEFKAHEGEIED Gene ID Swiss Prot Synonyms SEC12 Calculated MW 45kDa Observed MW 46kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples Hep G2, MCF7, K-562, Mouse brain, Rat brain Cellular location Endoplasmic reticulum membrane, Nucleus 
Western blot analysis of extracts of various cell lines, using PREB antibody (A20957) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Western blot analysis of extracts of various cell lines, using PREB antibody (A20957) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.
Immunofluorescence analysis of NIH/3T3 cells using PREB Rabbit mAb (A20957) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of PC-12 cells using PREB Rabbit mAb (A20957) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 89-201 of human PREB (NP_037520.1). Isotype IgG