быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Mras Rabbit mAb (A20958)
- Описание
- Характеристики
-
Overview
Product name Mras Rabbit mAb Catalog No. A20958 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2946 Background
This gene encodes a member of the Ras family of small GTPases. These membrane-associated proteins function as signal transducers in multiple processes including cell growth and differentiation, and dysregulation of Ras signaling has been associated with many types of cancer. The encoded protein may play a role in the tumor necrosis factor-alpha and MAP kinase signaling pathways. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 109-208 of human Mras (O14807). Sequence LILRVKDRESFPMILVANKVDLMHLRKITREQGKEMATKHNIPYIETSAKDPPLNVDKAFHDLVRVIRQQIPEKSQKKKKKTKWRGDRATGTHKLQCVIL Gene ID Swiss Prot Synonyms NS11; M-RAs; RRAS3; R-RAS3 Calculated MW 24kDa Observed MW 24kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, C6, SH-SY5Y, Mouse lung, Mouse brain, Rat brain, Mouse kidney Cellular location Cell membrane 
Western blot analysis of extracts of various cell lines, using Mras antibody (A20958) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 109-208 of human Mras (O14807). Isotype IgG