быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
ATP5G1 Rabbit mAb (A20960)
- Описание
- Характеристики
-
Overview
Product name ATP5G1 Rabbit mAb Catalog No. A20960 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2948 Background
This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene is one of three genes that encode subunit c of the proton channel. Each of the three genes have distinct mitochondrial import sequences but encode the identical mature protein. Alternatively spliced transcript variants encoding the same protein have been identified.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 57-136 of human ATP5G1 (P05496). Sequence SVVSRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM Gene ID Swiss Prot Synonyms ATP5A; ATP5G; ATP5G1 Calculated MW 14kDa Observed MW 8kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples Mouse small intestine, Rat heart Cellular location Mitochondrial inner membrane, Mitochondrial proton-transporting ATP synthase complex, Mitochondrial proton-transporting ATP synthase complex, Coupling factor F(o), Mitochondrion 
Western blot analysis of extracts of various cell lines, using ATP5G1 antibody (A20960) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunohistochemistry analysis of paraffin-embedded human liver cancer using ATP5G1 Rabbit mAb (A20960) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse heart using ATP5G1 Rabbit mAb (A20960) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded rat testis using ATP5G1 Rabbit mAb (A20960) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 57-136 of human ATP5G1 (P05496). Isotype IgG