быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
ATP5G1 Rabbit mAb (A20961)
- Описание
- Характеристики
-
Overview
Product name ATP5G1 Rabbit mAb Catalog No. A20961 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2949 Background
This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene is one of three genes that encode subunit c of the proton channel. Each of the three genes have distinct mitochondrial import sequences but encode the identical mature protein. Alternatively spliced transcript variants encoding the same protein have been identified.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ATP5G1 (P05496). Sequence MQTAGALFISPALIRCCTRGLIRPVSASFLNSPVNSSKQPSYSNFPLQVARREFQTSVVSRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARN Gene ID Swiss Prot Synonyms ATP5A; ATP5G; ATP5G1 Calculated MW 14kDa Observed MW 8kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:2000 - 1:10000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples HL-60, Mouse heart, Mouse small intestine, Mouse liver, Rat heart, Rat brain Cellular location mitochondrial inner membrane, mitochondrial proton-transporting ATP synthase complex, mitochondrial proton-transporting ATP synthase complex, coupling factor F(o), mitochondrion 
Western blot analysis of extracts of various cell lines, using ATP5G1 antibody (A20961) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunofluorescence analysis of mouse heart using ATP5G1 antibody (A20961) at dilution of 1:100. Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ATP5G1 (P05496). Isotype IgG







