быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
MS4A14 Rabbit mAb (A20965)
- Описание
- Характеристики
-
Overview
Product name MS4A14 Rabbit mAb Catalog No. A20965 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2954 Background
Predicted to be integral component of membrane.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 150-280 of human MS4A14 (Q96JA4). Sequence FSRTLFIVLFFLPSDVTQNSEQPAPEENDQLQFVLQEEFSSDDSTTNAQSVIFGGYAFFKLTLSRSPLVSQPGNKGREFVPDEQKQSILPSPKFSEEEIEPLPPTLEKKPSENMSIQLDSTFKQMKDEDLQ Gene ID Swiss Prot Synonyms MS4A16; NYD-SP21 Calculated MW 77kDa Observed MW 76kDa Applications
Reactivity Rat Tested applications WB Recommended dilution - WB 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Rat testis Cellular location Plasma membrane 
Western blot analysis of extracts of various cell lines, using MS4A14 antibody (A20965) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 150-280 of human MS4A14 (Q96JA4). Isotype IgG