быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
KCTD9 Rabbit mAb (A20967)
- Описание
- Характеристики
-
Overview
Product name KCTD9 Rabbit mAb Catalog No. A20967 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2956 Background
Enables cullin family protein binding activity; identical protein binding activity; and protein self-association. Predicted to be involved in intracellular signal transduction; protein homooligomerization; and protein ubiquitination.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human KCTD9 (Q7L273). Sequence MRRVTLFLNGSPKNGKVVAVYGTLSDLLSVASSKLGIKATSVYNGKGGLIDDIALIRDDDVLFVCEGEPFIDPQTDSKPPEGLLGFHTDWLTLNVGGRYF Gene ID Swiss Prot Synonyms BTBD27 Calculated MW 43kDa Observed MW 45kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples K-562, U2OS Cellular location 
Western blot analysis of extracts of various cell lines, using KCTD9 antibody (A20967) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human KCTD9 (Q7L273). Isotype IgG