быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
MDH2 Rabbit mAb (A20968)
- Описание
- Характеристики
-
Overview
Product name MDH2 Rabbit mAb Catalog No. A20968 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2957 Background
Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. The protein encoded by this gene is localized to the mitochondria and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria. Several transcript variants encoding different isoforms have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human MDH2 (P40926). Sequence VSRLTLYDIAHTPGVAADLSHIETKAAVKGYLGPEQLPDCLKGCDVVVIPAGVPRKPGMTRDDLFNTNATIVATLTAACAQHCPEAMICVIANPVNSTIPI Gene ID Swiss Prot Synonyms MDH; MOR1; DEE51; M-MDH; EIEE51; MGC:3559 Calculated MW 36kDa Observed MW 36kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:100 - 1:500
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples HeLa, A-431, NIH/3T3, U-87MG, Mouse small intestine, Rat kidney Cellular location Mitochondrion matrix 
Western blot analysis of extracts of Rat kidney, using MDH2 antibody (A20968) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
Western blot analysis of extracts of various cell lines, using MDH2 antibody (A20968) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded human esophagus using MDH2 Rabbit mAb (A20968) at dilution of 1:20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human liver using MDH2 Rabbit mAb (A20968) at dilution of 1:20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse kidney using MDH2 Rabbit mAb (A20968) at dilution of 1:20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse spleen using MDH2 Rabbit mAb (A20968) at dilution of 1:20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded rat brain using MDH2 Rabbit mAb (A20968) at dilution of 1:20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human MDH2 (P40926). Isotype IgG