быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
FPGS Rabbit mAb (A20973)
- Описание
- Характеристики
-
Overview
Product name FPGS Rabbit mAb Catalog No. A20973 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2964 Background
This gene encodes the folylpolyglutamate synthetase enzyme. This enzyme has a central role in establishing and maintaining both cytosolic and mitochondrial folylpolyglutamate concentrations and, therefore, is essential for folate homeostasis and the survival of proliferating cells. This enzyme catalyzes the ATP-dependent addition of glutamate moieties to folate and folate derivatives. Alternative splicing results in transcript variants encoding different isoforms.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 450-587 of human FPGS (Q05932). Sequence NADQQNFTVTLDQVLLRCLEHQQHWNHLDEEQASPDLWSAPSPEPGGSASLLLAPHPPHTCSASSLVFSCISHALQWISQGRDPIFQPPSPPKGLLTHPVAHSGASILREAAAIHVLVTGSLHLVGGVLKLLEPALSQ Gene ID Swiss Prot Synonyms Calculated MW 65kDa Observed MW 65kDa Applications
Reactivity Human, Rat Tested applications WB Recommended dilution - WB 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples PC-3, MCF7, MOLT-4, Jurkat, Rat lung Cellular location cytoplasm, cytosol, mitochondrial inner membrane, mitochondrial matrix, mitochondrion 
Western blot analysis of extracts of various cell lines, using FPGS antibody (A20973) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 450-587 of human FPGS (Q05932). Isotype IgG