быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
PRMT7 Rabbit mAb (A20975)
- Описание
- Характеристики
-
Overview
Product name PRMT7 Rabbit mAb Catalog No. A20975 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2967 Background
This gene encodes a member of the protein arginine N-methyltransferase family of proteins. The encoded enzyme transfers single methyl groups to arginine residues to generate monomethylarginines on histone proteins as well as other protein substrates. This enzyme plays a role in a wide range of biological processes, including neuronal differentiation, male germ line imprinting, small nuclear ribonucleoprotein biogenesis, and regulation of the Wnt signaling pathway. Mutations in this gene underlie multiple related syndromes in human patients characterized by intellectual disability, short stature and other features. The encoded protein may promote breast cancer cell invasion and metastasis in human patients.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PRMT7 (Q9NVM4). Sequence MKIFCSRANPTTGSVEWLEEDEHYDYHQEIARSSYADMLHDKDRNVKYYQGIRAAVSRVKDRGQKALVLDIGTGTGLLSMMAVTAGADFCYAIEVFKPMA Gene ID Swiss Prot Synonyms SBIDDS Calculated MW 78kDa Observed MW 78kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, SW620, MCF7, NIH/3T3, Mouse testis, Mouse brain, Rat testis, Rat brain Cellular location Cytoplasm, Nucleus, cytosol 
Western blot analysis of extracts of various cell lines, using PRMT7 antibody (A20975) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PRMT7 (Q9NVM4). Isotype IgG







