быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
RAB8A Rabbit mAb (A20976)
- Описание
- Характеристики
-
Overview
Product name RAB8A Rabbit mAb Catalog No. A20976 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2968 Background
The protein encoded by this gene is a member of the RAS superfamily which are small GTP/GDP-binding proteins with an average size of 200 amino acids. The RAS-related proteins of the RAB/YPT family may play a role in the transport of proteins from the endoplasmic reticulum to the Golgi and the plasma membrane. This protein shares 97%, 96%, and 51% similarity with the dog RAB8, mouse MEL, and mouse YPT1 proteins, respectively and contains the 4 GTP/GDP-binding sites that are present in all the RAS proteins. The putative effector-binding site of this protein is similar to that of the RAB/YPT proteins. However, this protein contains a C-terminal CAAX motif that is characteristic of many RAS superfamily members but which is not found in YPT1 and the majority of RAB proteins. Although this gene was isolated as a transforming gene from a melanoma cell line, no linkage between MEL and malignant melanoma has been demonstrable. This oncogene is located 800 kb distal to MY09B on chromosome 19p13.1.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-207 of human RAB8A (P61006). Sequence RNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFRCVLL Gene ID Swiss Prot Synonyms MEL; RAB8 Calculated MW 24kDa Observed MW 24kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC IP Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
- IP 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Immunoprecipitation Positive samples HeLa, HCT 116, Mouse brain, Mouse thymus, Rat spinal cord Cellular location Cell membrane, Cell projection, Cytoplasm, Cytoplasmic side, Cytoplasmic vesicle, Golgi apparatus, Lipid-anchor, Recycling endosome membrane, centriole, centrosome, cilium, cilium basal body, cytoskeleton, microtubule organizing center, phagosome, phagosome membrane 
Western blot analysis of extracts of various cell lines, using RAB8A antibody (A20976) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
Western blot analysis of extracts of Rat spinal cord, using RAB8A antibody (A20976) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Immunofluorescence analysis of NIH/3T3 cells using RAB8A Rabbit mAb (A20976) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of PC-12 cells using RAB8A Rabbit mAb (A20976) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunoprecipitation analysis of 600 μg extracts of Mouse brain cells using 3 μg RAB8A antibody (A20976). Western blot was performed from the immunoprecipitate using RAB8A antibody (A20976) at a dilution of 1:1000.
-
Key applications Western blotting, Immunofluorescence, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-207 of human RAB8A (P61006). Isotype IgG