быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
PRPF31 Rabbit mAb (A20979)
- Описание
- Характеристики
-
Overview
Product name PRPF31 Rabbit mAb Catalog No. A20979 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2971 Background
This gene encodes a component of the spliceosome complex and is one of several retinitis pigmentosa-causing genes. When the gene product is added to the spliceosome complex, activation occurs.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 350-450 of human PRPF31 (Q8WWY3). Sequence QRKKRGGRRYRKMKERLGLTEIRKQANRMSFGEIEEDAYQEDLGFSLGHLGKSGSGRVRQTQVNEATKARISKTLQRTLQKQSVVYGGKSTIRDRSSGTAS Gene ID Swiss Prot Synonyms RP11; PRP31; SNRNP61; NY-BR-99 Calculated MW 55kDa Observed MW 60kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, A-549, Jurkat Cellular location Cajal body, Nucleus, Nucleus speckle 
Western blot analysis of extracts of various cell lines, using PRPF31 antibody (A20979) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 350-450 of human PRPF31 (Q8WWY3). Isotype IgG