быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
PKM2-specific Rabbit mAb (A20991)
- Описание
- Характеристики
-
Overview
Product name PKM2-specific Rabbit mAb Catalog No. A20991 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC50919 Background
This gene encodes a protein involved in glycolysis. The encoded protein is a pyruvate kinase that catalyzes the transfer of a phosphoryl group from phosphoenolpyruvate to ADP, generating ATP and pyruvate. This protein has been shown to interact with thyroid hormone and may mediate cellular metabolic effects induced by thyroid hormones. This protein has been found to bind Opa protein, a bacterial outer membrane protein involved in gonococcal adherence to and invasion of human cells, suggesting a role of this protein in bacterial pathogenesis. Several alternatively spliced transcript variants encoding a few distinct isoforms have been reported.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 380-480 of human PKM2-specific (NP_002645.3). Sequence LIAREAEAAIYHLQLFEELRRLAPITSDPTEATAVGAVEASFKCCSGAIIVLTKSGRSAHQVARYRPRAPIIAVTRNPQTARQAHLYRGIFPVLCKDPVQE Gene ID Swiss Prot Synonyms PK3; TCB; p58; OIP3; PKM2; CTHBP; THBP1; HEL-S-30 Calculated MW 58kDa Observed MW 60kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC IP Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
- IP 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Immunoprecipitation Positive samples HeLa, NIH/3T3, C6 Cellular location Cytoplasm, Nucleus 
Western blot analysis of various lysates, using PKM2-specific antibody (A20991) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
Immunofluorescence analysis of A-204 cells using PKM2-specific Rabbit mAb (A20991) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH/3T3 cells using PKM2-specific Rabbit mAb (A20991) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunoprecipitation analysis of 300 μg extracts from HeLa cells using 3 μg PKM2-specific Rabbit mAb (A20991). Western blot was performed from the immunoprecipitate using PKM2-specific Rabbit mAb (A20991) at a dilution of 1:1000.
-
Key applications Western blotting, Immunofluorescence, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 380-480 of human PKM2-specific (NP_002645.3). Isotype IgG