быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
IRE1 Rabbit mAb (A21021)
- Описание
- Характеристики
-
Overview
Product name IRE1 Rabbit mAb Catalog No. A21021 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC57190 Background
This gene encodes the transmembrane protein kinase inositol-requiring enzyme 1. The encoded protein contains two functional catalytic domains, a serine/threonine-protein kinase domain and an endoribonuclease domain. This protein functions as a sensor of unfolded proteins in the endoplasmic reticulum (ER) and triggers an intracellular signaling pathway termed the unfolded protein response (UPR). The UPR is an ER stress response that is conserved from yeast to mammals and activates genes involved in degrading misfolded proteins, regulating protein synthesis and activating molecular chaperones. This protein specifically mediates the splicing and activation of the stress response transcription factor X-box binding protein 1.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 286-435 of human IRE1 (NP_001424.3). Sequence VGKYSTSLYASPSMVHEGVAVVPRGSTLPLLEGPQTDGVTIGDKGECVITPSTDVKFDPGLKSKNKLNYLRNYWLLIGHHETPLSASTKMLERFPNNLPKHRENVIPADSEKKSFEEVINLVDQTSENAPTTVSRDVEEKPAHAPARPEA Gene ID Swiss Prot Synonyms IRE1; IRE1P; IRE1a; hIRE1p Calculated MW 110kDa Observed MW 130kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples 293T, LNCaP, SK-N-SH(Low expression control), C2C12, Mouse thymus, Rat brain Cellular location Endoplasmic reticulum membrane, Single-pass type I membrane protein 
Western blot analysis of various lysates, using IRE1 antibody (A21021) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Western blot analysis of various lysates, using IRE1 antibody (A21021) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 120s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 286-435 of human IRE1 (NP_001424.3). Isotype IgG







