быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
PKM1-specific Rabbit mAb (A21052)
- Описание
- Характеристики
-
Overview
Product name PKM1-specific Rabbit mAb Catalog No. A21052 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC50938 Background
This gene encodes a protein involved in glycolysis. The encoded protein is a pyruvate kinase that catalyzes the transfer of a phosphoryl group from phosphoenolpyruvate to ADP, generating ATP and pyruvate. This protein has been shown to interact with thyroid hormone and may mediate cellular metabolic effects induced by thyroid hormones. This protein has been found to bind Opa protein, a bacterial outer membrane protein involved in gonococcal adherence to and invasion of human cells, suggesting a role of this protein in bacterial pathogenesis. Several alternatively spliced transcript variants encoding a few distinct isoforms have been reported.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 350-450 of human PKM1 (NP_001193728.1). Sequence GSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHLIAREAEAAMFHRKLFEELVRASSHSTDLMEAMAMGSVEASYKCLAAALIVLTESGRSAHQVARYR Gene ID Swiss Prot Synonyms PK3; TCB; p58; OIP3; PKM2; CTHBP; THBP1; HEL-S-30 Calculated MW 58kDa Observed MW 60kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples RD, Mouse skeletal muscle, Rat skeletal muscle, Rat brain Cellular location Cytoplasm, Nucleus 
Western blot analysis of extracts of RD cells, using PKM1-specific antibody (A21052) at1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Western blot analysis of extracts of various cell lines, using PKM1-specific antibody (A21052) at1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 350-450 of human PKM1 (NP_001193728.1). Isotype IgG