быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Interferon alpha 1 (IFN-α1) Rabbit mAb (A21081)
- Описание
- Характеристики
-
Overview
Product name Interferon alpha 1 (IFN-α1) Rabbit mAb Catalog No. A21081 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC52133 Background
This gene is a member of the alpha interferon gene cluster on chromosome 9. The encoded cytokine is a member of the type I interferon family that is produced in response to viral infection as a key part of the innate immune response with potent antiviral, antiproliferative and immunomodulatory properties. This cytokine, like other type I interferons, binds a plasma membrane receptor made of IFNAR1 and IFNAR2 that is ubiquitously expressed, and thus is able to act on virtually all body cells. This cytokine is upregulated in preeclamptic placentas and is thought to be a mediator of preeclampsia.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 24-189 of human Interferon alpha 1 (IFN-α1) (NP_076918.1). Sequence CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE Gene ID Swiss Prot Synonyms IFL; IFN; IFNA@; IFNA13; leIF D; IFN-ALPHA; IFN-alphaD Calculated MW 22kDa Observed MW 18kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Recombinant Human IFNA1 Protein Cellular location Secreted 
Western blot analysis of extracts of Recombinant Human IFNA1 Protein, using Interferon alpha 1 (IFN-α1) antibody (A21081) at1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 24-189 of human Interferon alpha 1 (IFN-α1) (NP_076918.1). Isotype IgG