быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
SNX5 Rabbit mAb (A21150)
- Описание
- Характеристики
-
Overview
Product name SNX5 Rabbit mAb Catalog No. A21150 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2985 Background
This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein functions in endosomal sorting, the phosphoinositide-signaling pathway, and macropinocytosis. This gene may play a role in the tumorigenesis of papillary thyroid carcinoma. Alternative splicing results in multiple transcript variants encoding different isoforms.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 28-127aa of human SNX5. Sequence DPSLQIDIPDALSERDKVKFTVHTKTTLPTFQSPEFSVTRQHEDFVWLHDTLIETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEFAKMKQE Gene ID Swiss Prot Synonyms SNX5 Calculated MW 47kDa Observed MW 47kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples HepG2, Jurkat, Mouse spleen, Rat thymus Cellular location Cell membrane, Cell projection, Cytoplasm, Cytoplasmic side, Cytoplasmic vesicle membrane, Early endosome, Early endosome membrane, Endosome, Peripheral membrane protein, phagocytic cup, ruffle 
Western blot analysis of various lysates, using SNX5 antibody (A21150) at1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 180s.
Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using SNX5 Rabbit mAb (A21150) at dilution of 1:50(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human thyroid cancer using SNX5 Rabbit mAb (A21150) at dilution of 1:50(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse kidney using SNX5 Rabbit mAb (A21150) at dilution of 1:50(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse liver using SNX5 Rabbit mAb (A21150) at dilution of 1:50(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded rat stomach using SNX5 Rabbit mAb (A21150) at dilution of 1:50(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 28-127aa of human SNX5. Isotype IgG