быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
PLZF Rabbit mAb (A21185)
- Описание
- Характеристики
-
Overview
Product name PLZF Rabbit mAb Catalog No. A21185 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC52265 Background
This gene is a member of the Krueppel C2H2-type zinc-finger protein family and encodes a zinc finger transcription factor that contains nine Kruppel-type zinc finger domains at the carboxyl terminus. This protein is located in the nucleus, is involved in cell cycle progression, and interacts with a histone deacetylase. Specific instances of aberrant gene rearrangement at this locus have been associated with acute promyelocytic leukemia (APL). Alternate transcriptional splice variants have been characterized.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 199-300 of human PLZF (NP_005997.2). Sequence TKAAVDSLMTIGQSLLQGTLQPPAGPEEPTLAGGGRHPGVAEVKTEMMQVDEVPSQDSPGAAESSISGGMGDKVEERGKEGPGTPTRSSVITSARELHYGRE Gene ID Swiss Prot Synonyms PLZF; ZNF145 Calculated MW 74kDa Observed MW 80kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:2000 - 1:10000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples 293F, Mouse heart, Rat brain Cellular location Nucleus 
Western blot analysis of extracts of various cell lines, using PLZF antibody (A21185) at 1:10000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Western blot analysis of extracts of Mouse heart, using PLZF antibody (A21185) at 1:10000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 199-300 of human PLZF (NP_005997.2). Isotype IgG