быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
BOK Rabbit mAb (A21196)
- Описание
- Характеристики
-
Overview
Product name BOK Rabbit mAb Catalog No. A21196 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC53171 Background
The protein encoded by this gene belongs to the BCL2 family, members of which form homo- or heterodimers, and act as anti- or proapoptotic regulators that are involved in a wide variety of cellular processes. Studies in rat show that this protein has restricted expression in reproductive tissues, interacts strongly with some antiapoptotic BCL2 proteins, not at all with proapoptotic BCL2 proteins, and induces apoptosis in transfected cells. Thus, this protein represents a proapoptotic member of the BCL2 family.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human BOK (NP_115904.1). Sequence MEVLRRSSVFAAEIMDAFDRSPTDKELVAQAKALGREYVHARLLRAGLSWSAPERAAPVPGRLAEVCAVLLRLGDELEMIRPSVYRNVARQLHISLQSEP Gene ID Swiss Prot Synonyms BOKL; BCL2L9 Calculated MW 23kDa Observed MW 23kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:1000 - 1:5000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples PC-3, Mouse brain, Rat testis Cellular location Endoplasmic reticulum membrane, Golgi apparatus membrane, Single-pass membrane protein 
Western blot analysis of extracts of PC-3 cells, using BOK antibody (A21196) at1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:200000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Western blot analysis of extracts of various cell lines, using BOK antibody (A21196) at1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:200000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human BOK (NP_115904.1). Isotype IgG