быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
STAT5A Rabbit mAb (A21228)
- Описание
- Характеристики
-
Overview
Product name STAT5A Rabbit mAb Catalog No. A21228 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC52814 Background
The protein encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein is activated by, and mediates the responses of many cell ligands, such as IL2, IL3, IL7 GM-CSF, erythropoietin, thrombopoietin, and different growth hormones. Activation of this protein in myeloma and lymphoma associated with a TEL/JAK2 gene fusion is independent of cell stimulus and has been shown to be essential for tumorigenesis. The mouse counterpart of this gene is found to induce the expression of BCL2L1/BCL-X(L), which suggests the antiapoptotic function of this gene in cells. Alternatively spliced transcript variants have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human STAT5A (NP_003143.2). Sequence MAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAQWIESQPWDAIDLDNPQDRAQATQLLEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQKTYDR Gene ID Swiss Prot Synonyms MGF; STAT5 Calculated MW 91kDa Observed MW 100kDa Applications
Reactivity Human, Mouse Tested applications WB Recommended dilution - WB 1:10000 - 1:30000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples K-562, PC-3, HeLa, Mouse liver Cellular location Cytoplasm, Nucleus 
Western blot analysis of extracts of various cell lines, using STAT5A antibody (A21228) at 1:20000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human STAT5A (NP_003143.2). Isotype IgG







