быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
CLCN1 Rabbit mAb (A21237)
- Описание
- Характеристики
-
Overview
Product name CLCN1 Rabbit mAb Catalog No. A21237 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC52491 Background
The CLCN family of voltage-dependent chloride channel genes comprises nine members (CLCN1-7, Ka and Kb) which demonstrate quite diverse functional characteristics while sharing significant sequence homology. The protein encoded by this gene regulates the electric excitability of the skeletal muscle membrane. Mutations in this gene cause two forms of inherited human muscle disorders: recessive generalized myotonia congenita (Becker) and dominant myotonia (Thomsen). Alternative splicing results in multiple transcript variants.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 889-988 of human CLCN1 (NP_000074.3). Sequence NTTSTRKSTGAPPSSAENWNLPEDRPGATGTGDVIAASPETPVPSPSPEPPLSLAPGKVEGELEELELVESPGLEEELADILQGPSLRSTDEEDEDELIL Gene ID Swiss Prot Synonyms CLC1 Calculated MW 109kDa Observed MW 109kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:2000 - 1:20000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples 293T Cellular location Membrane, Multi-pass membrane protein 
Western blot analysis of various lysates, using CLCN1 antibody (A21237) at 1:20000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 889-988 of human CLCN1 (NP_000074.3). Isotype IgG