быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
COX7A1 Rabbit mAb (A21240)
- Описание
- Характеристики
-
Overview
Product name COX7A1 Rabbit mAb Catalog No. A21240 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC53426 Background
Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes polypeptide 1 (muscle isoform) of subunit VIIa and the polypeptide 1 is present only in muscle tissues. Other polypeptides of subunit VIIa are present in both muscle and nonmuscle tissues, and are encoded by different genes.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-79 of human COX7A1 (NP_001855.1). Sequence MQALRVSQALIRSFSSTARNRFQNRVREKQKLFQEDNDIPLYLKGGIVDNILYRVTMTLCLGGTVYSLYSLGWASFPRN Gene ID Swiss Prot Synonyms COX7A; COX7AH; COX7AM Calculated MW 9kDa Observed MW 9kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:2000 - 1:20000
- IHC-P 1:2000 - 1:6000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples A549, 293T, Mouse heart, Rat heart, Rat skeletal muscle Cellular location Mitochondrion inner membrane 
Western blot analysis of Mouse heart, using COX7A1 antibody (A21240) at 1:20000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Western blot analysis of various lysates, using COX7A1 antibody (A21240) at 1:20000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.
Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using COX7A1 Rabbit mAb (A21240) at dilution of 1:5000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded Human skeletal muscle using COX7A1 Rabbit mAb (A21240) at dilution of 1:5000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Confocal imaging of Human heart using COX7A1 Rabbit mAb(A21240, 1:100)(Red).DAPI was used for nuclear staining(blue).Objective:40x.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-79 of human COX7A1 (NP_001855.1). Isotype IgG