- 100 μL
- 200 μL
- 50 μL
- Описание
- Характеристики
-
Overview
Product name LIN28A Rabbit mAb Catalog No. A21261 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC53062 Background
This gene encodes a LIN-28 family RNA-binding protein that acts as a posttranscriptional regulator of genes involved in developmental timing and self-renewal in embryonic stem cells. The encoded protein functions through direct interaction with target mRNAs and by disrupting the maturation of certain miRNAs involved in embryonic development. This protein prevents the terminal processing of the LET7 family of microRNAs which are major regulators of cellular growth and differentiation. Aberrant expression of this gene is associated with cancer progression in multiple tissues.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-209 of human LIN28A (NP_078950.1). Sequence SAKGLESIRVTGPGGVFCIGSERRPKGKSMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQGPSAQGKPTYFREEEEEIHSPTLLPEAQN Gene ID Swiss Prot Synonyms CSDD1; LIN28; LIN-28; ZCCHC1; lin-28A Calculated MW 23kDa Observed MW 28kDa Applications
Reactivity Human, Mouse Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:10000 - 1:70000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples T-47D, NCCIT Cellular location Cytoplasm, Nucleus, nucleolus 
Western blot analysis of extracts of various cell lines, using LIN28A antibody (A21261) at 1:60000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.
Immunohistochemistry analysis of paraffin-embedded Human embryonic carcinoma using LIN28A Rabbit mAb (A21261) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human placenta using LIN28A Rabbit mAb (A21261) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Human seminoma using LIN28A Rabbit mAb (A21261) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Confocal imaging of HeLa cells using LIN28A Rabbit mAb (A21261, dilution 1:200)(Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 60x.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-209 of human LIN28A (NP_078950.1). KO Validated Validated Isotype IgG







