быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
GATA1 Rabbit mAb (A21262)
- Описание
- Характеристики
-
Overview
Product name GATA1 Rabbit mAb Catalog No. A21262 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC53588 Background
This gene encodes a protein which belongs to the GATA family of transcription factors. The protein plays an important role in erythroid development by regulating the switch of fetal hemoglobin to adult hemoglobin. Mutations in this gene have been associated with X-linked dyserythropoietic anemia and thrombocytopenia.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GATA1 (NP_002040.1). Sequence MEFPGLGSLGTSEPLPQFVDPALVSSTPESGVFFPSGPEGLDAAASSTAPSTATAAAAALAYYRDAEAYRHSPVFQVYPLLNCMEGIPGGSPYAGWAYGK Gene ID Swiss Prot Synonyms GF1; GF-1; NFE1; XLTT; ERYF1; NF-E1; XLANP; XLTDA; GATA-1; HAEADA Calculated MW 43kDa Observed MW 47kDa Applications
Reactivity Human Tested applications WB IP Recommended dilution - WB 1:000 - 1:5000
- IP 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunoprecipitation Positive samples HEL Cellular location Nucleus 
Western blot analysis of various lysates, using GATA1 antibody (A21262) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s. -
Key applications Western blotting, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GATA1 (NP_002040.1). Isotype IgG