быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
CMTM6 Rabbit mAb (A21292)
- Описание
- Характеристики
-
Overview
Product name CMTM6 Rabbit mAb Catalog No. A21292 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC53656 Background
This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and transmembrane 4 superfamilies. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 3. This gene is widely expressed in many tissues, but the exact function of the encoded protein is unknown.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 84-183 of human CMTM6 (NP_060271.1). Sequence LILIVYCTPFYERVDTTKVKSSDFYITLGTGCVFLLASIIFVSTHDRTSAEIAAIVFGFIASFMFLLDFITMLYEKRQESQLRKPENTTRAEALTEPLNA Gene ID Swiss Prot Synonyms CKLFSF6; PRO2219 Calculated MW 20kDa Observed MW 20-22kDa Applications
Reactivity Human, Rat Tested applications WB Recommended dilution - WB 1:2000 - 1:10000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples U-937, Rat lung Cellular location plasma membrane 
Western blot analysis of extracts of various cell lines, using CMTM6 antibody (A21292) at1:20000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
Western blot analysis of extracts of Rat lung, using CMTM6 antibody (A21292) at 1:10000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 84-183 of human CMTM6 (NP_060271.1). Isotype IgG