быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Mitofusin-1/MFN1 Rabbit mAb (A21293)
- Описание
- Характеристики
-
Overview
Product name Mitofusin-1/MFN1 Rabbit mAb Catalog No. A21293 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC54223 Background
The protein encoded by this gene is a mediator of mitochondrial fusion. This protein and mitofusin 2 are homologs of the Drosophila protein fuzzy onion (Fzo). They are mitochondrial membrane proteins that interact with each other to facilitate mitochondrial targeting.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 642-741 of human Mitofusin-1/MFN1 (NP_284941.2). Sequence FKQQFVNYATEKLRMIVSSTSANCSHQVKQQIATTFARLCQQVDITQKQLEEEIARLPKEIDQLEKIQNNSKLLRNKAVQLENELENFTKQFLPSSNEES Gene ID Swiss Prot Synonyms hfzo1; hfzo2 Calculated MW 84kDa Observed MW 84kDa Applications
Reactivity Human, Mouse Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Mouse brain Cellular location Cytoplasm, Mitochondrion outer membrane, Multi-pass membrane protein Customer validation WB(Homo sapiens, Mus musculus)
Western blot analysis of Mouse brain, using Mitofusin-1/MFN1 antibody (A21293) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 642-741 of human Mitofusin-1/MFN1 (NP_284941.2). Isotype IgG