быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Glutamine Synthetase (GLUL) Rabbit mAb (A21856)
- Описание
- Характеристики
-
Overview
Product name Glutamine Synthetase (GLUL) Rabbit mAb Catalog No. A21856 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0120 Background
The protein encoded by this gene belongs to the glutamine synthetase family. It catalyzes the synthesis of glutamine from glutamate and ammonia in an ATP-dependent reaction. This protein plays a role in ammonia and glutamate detoxification, acid-base homeostasis, cell signaling, and cell proliferation. Glutamine is an abundant amino acid, and is important to the biosynthesis of several amino acids, pyrimidines, and purines. Mutations in this gene are associated with congenital glutamine deficiency, and overexpression of this gene was observed in some primary liver cancer samples. There are six pseudogenes of this gene found on chromosomes 2, 5, 9, 11, and 12. Alternative splicing results in multiple transcript variants.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Glutamine Synthetase (GLUL) (P15104). Sequence AQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRL Gene ID Swiss Prot Synonyms GS; GLNS; PIG43; PIG59 Calculated MW 42kDa Observed MW Refer to figures Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples Mouse kidney, Mouse liver, Mouse brain, Rat brain, Rat liver, Jurkat, HepG2, SH-SY5Y Cellular location Cytoplasm, Mitochondrion 
Western blot analysis of extracts of various cell lines, using Glutamine Synthetase (GLUL) (GLUL) antibody (A21856) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of extracts of various cell lines, using Glutamine Synthetase (GLUL) (GLUL) antibody (A21856) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1min.
Immunohistochemistry of paraffin-embedded human kidney using Glutamine Synthetase (GLUL) Rabbit mAb (A21856) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded human liver using Glutamine Synthetase (GLUL) Rabbit mAb (A21856) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded human tonsil using Glutamine Synthetase (GLUL) Rabbit mAb (A21856) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded rat colon using Glutamine Synthetase (GLUL) Rabbit mAb (A21856) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Glutamine Synthetase (GLUL) (P15104). Isotype IgG