быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Bcl-2 Rabbit mAb (A21873)
- Описание
- Характеристики
-
Overview
Product name Bcl-2 Rabbit mAb Catalog No. A21873 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2580 Background
This gene encodes an integral outer mitochondrial membrane protein that blocks the apoptotic death of some cells such as lymphocytes. Constitutive expression of BCL2, such as in the case of translocation of BCL2 to Ig heavy chain locus, is thought to be the cause of follicular lymphoma. Alternative splicing results in multiple transcript variants.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Bcl-2 (P10415). Sequence MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQA Gene ID Swiss Prot Synonyms Bcl-2; PPP1R50 Calculated MW 26kDa Observed MW 26kDa Applications
Reactivity Human Tested applications WB IHC-P IP Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
- IP 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunoprecipitation Positive samples Jurkat Cellular location Endoplasmic reticulum membrane, Mitochondrion outer membrane, Nucleus membrane, Single-pass membrane protein 
Immunohistochemistry analysis of paraffin-embedded human tonsil using Bcl-2 Rabbit mAb (A21873) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunoprecipitation analysis of 300 μg extracts of Jurkat cells using 3 μg Bcl-2 antibody (A21873). Western blot was performed from the immunoprecipitate using Bcl-2 antibody (A21873) at a dilution of 1:1000.
-
Key applications Western blotting, Immunohistochemistry, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Bcl-2 (P10415). Isotype IgG