быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
CD47 Rabbit mAb (A21904)
- Описание
- Характеристики
-
Overview
Product name CD47 Rabbit mAb Catalog No. A21904 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC51804 Background
This gene encodes a membrane protein, which is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The encoded protein is also a receptor for the C-terminal cell binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This gene has broad tissue distribution, and is reduced in expression on Rh erythrocytes. Alternatively spliced transcript variants have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 224-323 of human CD47 (NP_001768.1). Sequence HYYVFSTAIGLTSFVIAILVIQVIAYILAVVGLSLCIAACIPMHGPLLISGLSILALAQLLGLVYMKFVASNQKTIQPPRKAVEEPLNAFKESKGMMNDE Gene ID Swiss Prot Synonyms IAP; OA3; MER6 Calculated MW 35kDa Observed MW 45-50kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB FC Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Flow Cytometry Positive samples Jurkat, Mouse kidney, Mouse spleen, Rat kidney Cellular location Cell membrane, Multi-pass membrane protein 
Western blot analysis of extracts of various cell lines, using CD47 antibody (A21904) at1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of extracts of Jurkat cells, using CD47 antibody (A21904) at1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting, Flow Cytometry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 224-323 of human CD47 (NP_001768.1). Isotype IgG