быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
MyD88 Rabbit mAb (A21905)
- Описание
- Характеристики
-
Overview
Product name MyD88 Rabbit mAb Catalog No. A21905 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC52509 Background
This gene encodes a cytosolic adapter protein that plays a central role in the innate and adaptive immune response. This protein functions as an essential signal transducer in the interleukin-1 and Toll-like receptor signaling pathways. These pathways regulate that activation of numerous proinflammatory genes. The encoded protein consists of an N-terminal death domain and a C-terminal Toll-interleukin1 receptor domain. Patients with defects in this gene have an increased susceptibility to pyogenic bacterial infections. Alternate splicing results in multiple transcript variants.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human MyD88 (NP_002459.3). Sequence LAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTL Gene ID Swiss Prot Synonyms WM1; IMD68; MYD88D Calculated MW 33kDa Observed MW 33kDa Applications
Reactivity Mouse, Rat Tested applications WB Recommended dilution - WB 1:2000 - 1:7000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Mouse lung, Rat lung Cellular location Cytoplasm 
Western blot analysis of extracts of Mouse lung, using MyD88 antibody (A21905) at1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Western blot analysis of extracts of Rat lung, using MyD88 antibody (A21905) at1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human MyD88 (NP_002459.3). Isotype IgG